Spiritforged Pre-Rift Event Rules & 6 Mini Pre-Constructed Decks

With everyone eagerly waiting for Spiritforged’s official global release, we can’t forget about the Spiritforged Pre-Rift Event—a special sealed tournament taking place before launch. Running from February 6 to February 12, this event is a great way to kick things off and get hands-on with the new set as soon as it drops.

That said, the Spiritforged Pre-Rift Event will look a bit different from the pre-release event we had back when Origins launched, offering a fresh experience alongside the new cards.

Period:

February 6 to February 12.

Participation:

By participating in the Spiritforged Pre-Rift Event, you’ll get a Pre-Rift Player Kit that should cost around 30 USD.

The Pre-Rift Kit includes the following:

  • 1 Mini Pre-Constructed Deck (15 cards)
  • 5 Spiriforged Booster Packs
  • 1 Pre-Rift Pormo Card

6 Mini Pre-constructed Decks:

The Pre-Constructed deck in the Pre-Rift Kit can be one of 6 Spiriforged Legends. Rek'Sai Void Burrower, Irelia Blade Dancer, Jax Grandmaster at Arms, Lucian Purifier, Renata Glasc Chem-Baroness, Ezreal Prodigal Explorer.

Full Decks for each Legend:

CMAAAAAAAAAACAQAABM2MAIAAAAAAAIPAMAEEQ2FIZGU4UT2PR7ICAMEAGFADRYB24AQAAAAAA
SFD-199-1 SFD-215-1 SFD-122-1 SFD-124-1 SFD-066-1 SFD-069-1 SFD-129-1 SFD-138-1 SFD-067-1 SFD-070-1 SFD-078-1 SFD-126-1 SFD-077-1 SFD-082-1 SFD-132-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-166-1 OGN-166-1 OGN-166-1 OGN-166-1 OGN-166-1 OGN-166-1
Legend
 Ezreal, Prodigal Explorer Ezreal, Prodigal Explorer 1 0
Runes (12)
Mind Rune Mind Rune 6 0
Chaos Rune Chaos Rune 6 0
Battlefields (1)
Ravenbloom Conservatory Ravenbloom Conservatory 1 0
Main Deck (13)
7
Called Shot Called Shot 1 Chaos 0
Doran's Ring Doran's Ring 1 1
Frigid Touch Frigid Touch 1 2
Plundering Poro Plundering Poro 1 2
Temptation Temptation 1 2
Windsinger Windsinger 1 2
Frostcoat Cub Frostcoat Cub 1 3
Loyal Pup Loyal Pup 1 3
Temporal Portal Temporal Portal 1 3
Wages of Pain Wages of Pain 1 3
Ezreal, Dashing Ezreal, Dashing 1 Mind 4
Rocket Barrage Rocket Barrage 1 Mind 4
Beast Below Beast Below 1 Chaos Chaos 7

CMAAAAAAAAAACAQAABM5MAIAAAAAAAIPAMAD6QCFIZEEVGABTIAZWAM6AGRADJIBVMA4SAOWAEAAAAAA
SFD-201-1 SFD-214-1 SFD-063-1 SFD-064-1 SFD-069-1 SFD-155-1 SFD-162-1 SFD-070-1 SFD-074-1 SFD-154-1 SFD-072-1 SFD-171-1 SFD-158-1 SFD-165-1 SFD-152-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-089-1 OGN-214-1 OGN-214-1 OGN-214-1 OGN-214-1 OGN-214-1 OGN-214-1
Legend
Renata Glasc, Chem-Baroness Renata Glasc, Chem-Baroness 1 0
Runes (12)
Mind Rune Mind Rune 6 0
Order Rune Order Rune 6 0
Battlefields (1)
Power Nexus Power Nexus 1 0
Main Deck (13)
7
Chemtech Cask Chemtech Cask 1 1
Cloth Armor Cloth Armor 1 1
Blood Money Blood Money 1 2
Honest Broker Honest Broker 1 2
Plundering Poro Plundering Poro 1 2
Guards! Guards! 1 3
Pickpocket Pickpocket 1 3
Wages of Pain Wages of Pain 1 3
Dropboarder Dropboarder 1 4
Renata Glasc, Industrialist Renata Glasc, Industrialist 1 Order 4
Glasc Mixologist Glasc Mixologist 1 Order 5
Sandshifter Sandshifter 1 Order Order 5
Eminent Benefactor Eminent Benefactor 1 6

CMAAAAAAAAAACAQAAADX4AAAAAAACDYDAAAQEBYJBMIF6YDBMNVWY4NXAHNACAAAAAAA
SFD-183-1 SFD-218-1 SFD-009-1 SFD-097-1 SFD-108-1 SFD-001-1 SFD-007-1 SFD-011-1 SFD-016-1 SFD-095-1 SFD-099-1 SFD-096-1 SFD-107-1 SFD-113-1 SFD-002-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-126-1 OGN-126-1 OGN-126-1 OGN-126-1 OGN-126-1 OGN-126-1
Legend
Lucian, Purifier Lucian, Purifier 1 0
Runes (12)
Fury Rune Fury Rune 6 0
Body Rune Body Rune 6 0
Battlefields (1)
Sunken Temple Sunken Temple 1 0
Main Deck (13)
7
Punch First Punch First 1 Body Body 1
Serrated Dirk Serrated Dirk 1 1
Warmog's Armor Warmog's Armor 1 1
Against the Odds Against the Odds 1 2
Angle Shot Angle Shot 1 2
Doran's Blade Doran's Blade 1 2
Gem Jammer Gem Jammer 1 2
Recurve Bow Recurve Bow 1 2
Veteran Poro Veteran Poro 1 2
Laurent Bladekeeper Laurent Bladekeeper 1 3
Lucian, Merciless Lucian, Merciless 1 3
Strike Down Strike Down 1 Body 3
Armed Assailant Armed Assailant 1 Fury 6

CMAAAAAAAAAACAQAAAD5MAIAAAAAAAIPAMAAGBAGBIHRFFYBTQAZ2AM7AGQQDJABVIA3WAOZAEAAAAAA
SFD-187-1 SFD-217-1 SFD-003-1 SFD-004-1 SFD-018-1 SFD-151-1 SFD-159-1 SFD-006-1 SFD-010-1 SFD-015-1 SFD-156-1 SFD-157-1 SFD-161-1 SFD-164-1 SFD-170-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-007-1 OGN-214-1 OGN-214-1 OGN-214-1 OGN-214-1 OGN-214-1 OGN-214-1
Legend
Rek'Sai, Void Burrower Rek'Sai, Void Burrower 1 0
Runes (12)
Fury Rune Fury Rune 6 0
Order Rune Order Rune 6 0
Battlefields (1)
Seat of Power Seat of Power 1 0
Main Deck (13)
7
Blood Rush Blood Rush 1 1
Bonds of Strength Bonds of Strength 1 2
Bushwhack Bushwhack 1 Fury 2
Trusty Ramhound Trusty Ramhound 1 2
Void Hatchling Void Hatchling 1 2
Eager Drakehound Eager Drakehound 1 Fury 3
Void Drone Void Drone 1 3
B.F. Sword B.F. Sword 1 4
Laurent Duelist Laurent Duelist 1 4
Perched Grimwyrm Perched Grimwyrm 1 4
Royal Guard Royal Guard 1 4
Drag Under Drag Under 1 Order 5
Rek'Sai, Swarm Queen Rek'Sai, Swarm Queen 1 Order 5

CMAAAAAAAAAACAQAAAVH4AAAAAAACDYDAAQSGJJIFEVDMXC5L5RGM26BAHKQCAAAAAAA
SFD-193-1 SFD-213-1 SFD-033-1 SFD-040-1 SFD-041-1 SFD-042-1 SFD-095-1 SFD-098-1 SFD-102-1 SFD-107-1 SFD-037-1 SFD-093-1 SFD-054-1 SFD-092-1 SFD-035-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-126-1 OGN-126-1 OGN-126-1 OGN-126-1 OGN-126-1 OGN-126-1
Legend
Jax, Grandmaster at Arms Jax, Grandmaster at Arms 1 0
Runes (12)
Calm Rune Calm Rune 6 0
Body Rune Body Rune 6 0
Battlefields (1)
Ornn's Forge Ornn's Forge 1 0
Main Deck (13)
7
Doran's Shield Doran's Shield 1 1
Apprentice Smith Apprentice Smith 1 2
Brutalizer Brutalizer 1 2
Doran's Blade Doran's Blade 1 2
Hexdrinker Hexdrinker 1 2
Sea Monkey Sea Monkey 1 2
Thwonk! Thwonk! 1 2
Strike Down Strike Down 1 Body 3
Dauntless Vanguard Dauntless Vanguard 1 Body 4
Navori Scout Navori Scout 1 4
Combat Chef Combat Chef 1 5
Jax, Unmatched Jax, Unmatched 1 Calm 5
Guardian of the Passage Guardian of the Passage 1 6

CMAAAAAAAAAACAQAAAVKMAIAAAAAAAIPAMACEJBGE4WTA7D5P6BADBIBREAY2AODAHOACAAAAAAA
SFD-195-1 SFD-220-1 SFD-124-1 SFD-034-1 SFD-036-1 SFD-045-1 SFD-130-1 SFD-038-1 SFD-039-1 SFD-133-1 SFD-048-1 SFD-125-1 SFD-137-1 SFD-141-1 SFD-127-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-042-1 OGN-166-1 OGN-166-1 OGN-166-1 OGN-166-1 OGN-166-1 OGN-166-1
Legend
Irelia, Blade Dancer Irelia, Blade Dancer 1 0
Runes (12)
Calm Rune Calm Rune 6 0
Chaos Rune Chaos Rune 6 0
Battlefields (1)
Treasure Hoard Treasure Hoard 1 0
Main Deck (13)
7
Doran's Ring Doran's Ring 1 1
Feral Strength Feral Strength 1 2
Lonely Poro Lonely Poro 1 2
Not So Fast Not So Fast 1 Calm 2
Treasure Hunter Treasure Hunter 1 2
Boots of Swiftness Boots of Swiftness 1 3
Ribbon Dancer Ribbon Dancer 1 3
Royal Entourage Royal Entourage 1 Calm 3
Fae Porter Fae Porter 1 4
Harpoon Squad Harpoon Squad 1 4
Irelia, Graceful Irelia, Graceful 1 Chaos 4
Stellacorn Herder Stellacorn Herder 1 4
Master Bingwen Master Bingwen 1 6

Promo Card

Yone Blademaster

Build Your Deck

Sealed Event Rules:

1- Main Deck has to be 25 cards. You’ll build your deck from the mini pre-constructed deck + the booster packs you get. You do not have to play all the cards in your mini pre-constructed deck; you’re allowed to change things as you like.

2- You are not required to have a chosen champion. (If you don’t have a chosen champion in your deck, you’re allowed to draw an additional card on your first turn to even the playing field.)

3- Your champion doesn’t have to match your Legend. Unlike constructed, you can add any champion you want to your champion spot, even if it’s not the same name as your Legend. For example, if you’re playing Jax Grandmaster at Arms, you can run the promo Yone Blademaster as your chosen champion as long as it matches your deck’s domains.

4- You do not need to have a Legend. If you choose not to have a Legend in your deck, you get to draw an additional card on your first turn. (You only get 1 additional draw; you cannot draw 2 cards if you don’t have both a legend and a chosen champion).

5- Your deck may contain up to 3 domains (colors). If your deck has a Legend, your deck must match the two domains of the Legend, and you can choose to pick another 3rd different domain.

6- Signature cards don’t need to match your Legend, but the two Domains for Signature cards need to match your deck colors. For example, if you’re playing a Fury/Chaos/Calm deck, you cannot add Relentless Pursuit to your deck, as your deck doesn’t have the Body domain.

7- You need to have 12 Runes that match your chosen domains.

8- You will need 3 Battlefields for this event (they can be the same battlefield cards). However, if players don’t want to use a battlefield’s ability at all, they can flip it over as a blank battlefield.

Leave a Reply

Card Image
Card-ID Card Name
Cost 0
Might 0
Power
Type Unknown
Color Default
Ability
Tags:
Set
Rarity
View Card